![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
![]() | Protein automated matches [190526] (26 species) not a true protein |
![]() | Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries) |
![]() | Domain d5hzsf_: 5hzs F: [331027] automated match to d2gx2a_ complexed with co |
PDB Entry: 5hzs (more details), 2.17 Å
SCOPe Domain Sequences for d5hzsf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hzsf_ d.22.1.0 (F:) automated matches {Echinophyllia sp. [TaxId: 301887]} vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv vqlpdyhfvdhhieikshdkdysnvnlhehaeahse
Timeline for d5hzsf_: