Lineage for d5hzsc_ (5hzs C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940765Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2940894Domain d5hzsc_: 5hzs C: [330995]
    automated match to d2gx2a_
    complexed with co

Details for d5hzsc_

PDB Entry: 5hzs (more details), 2.17 Å

PDB Description: crystal structure of dronpa-co2+
PDB Compounds: (C:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d5hzsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hzsc_ d.22.1.0 (C:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse

SCOPe Domain Coordinates for d5hzsc_:

Click to download the PDB-style file with coordinates for d5hzsc_.
(The format of our PDB-style files is described here.)

Timeline for d5hzsc_: