Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
Family c.1.5.0: automated matches [227276] (1 protein) not a true family |
Protein automated matches [227084] (15 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [330485] (8 PDB entries) |
Domain d5uuwf1: 5uuw F:1-486 [330934] Other proteins in same PDB: d5uuwa2, d5uuwb2, d5uuwc2, d5uuwd2, d5uuwe2, d5uuwf2, d5uuwg2, d5uuwh2 automated match to d4q33e_ complexed with 8n1, edo, gol, imp, k |
PDB Entry: 5uuw (more details), 2.34 Å
SCOPe Domain Sequences for d5uuwf1:
Sequence, based on SEQRES records: (download)
>d5uuwf1 c.1.5.0 (F:1-486) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf agvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqegnkklvpegiegrvpykgp ladtvhqlvgglragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys
>d5uuwf1 c.1.5.0 (F:1-486) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf agvaespgeteiyqgrqfkvyrgmgsvgameklvpegiegrvpykgpladtvhqlvgglr agmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys
Timeline for d5uuwf1: