SCOPe 2.08: Domain d1f37b_: 1f37 B:

Lineage for d1f37b_ (1f37 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.11: Thioredoxin-like 2Fe-2S ferredoxin [52918] (1 protein)

6. Protein Thioredoxin-like 2Fe-2S ferredoxin [52919] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [52920] (4 PDB entries)

8. Domain d1f37b_: 1f37 B: [33089]
   complexed with fes, gol

Details for d1f37b_

PDB Entry: 1f37, 2.3 Å

PDB Description: structure of a thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus

PDB Compounds: (B:) ferredoxin [2fe-2s]

SCOPe Domain Sequences for d1f37b_:

Sequence; same for both SEQRES and ATOM records:

>d1f37b_ c.47.1.11 (B:) Thioredoxin-like 2Fe-2S ferredoxin {Aquifex aeolicus [TaxId: 63363]}
aefkhvfvcvqdrppghpqgscaqrgsrevfqafmekiqtdpqlfmttvitptgcmnacm
mgpvvvvypdgvwygqvkpedvdeivekhlkggepverlviskgkppgmf

Timeline for d1f37b_:

• d1f37b_ first appeared (with stable ids) in SCOP 1.55
  
• d1f37b_ appears in SCOPe 2.07