PDB entry 1f37

View 1f37 on RCSB PDB site
Description: structure of a thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus
Class: electron transport
Keywords: ferredoxin, [2Fe-2S] cluster, thioredoxin fold, ELECTRON TRANSPORT
Deposited on 2000-05-31, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.225
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin [2fe-2s]
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f37a_
  • Chain 'B':
    Compound: ferredoxin [2fe-2s]
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f37b_
  • Heterogens: FES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f37A (A:)
    aefkhvfvcvqdrppghpqgscaqrgsrevfqafmekiqtdpqlfmttvitptgcmnacm
    mgpvvvvypdgvwygqvkpedvdeivekhlkggepverlviskgkppgmf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f37A (A:)
    aefkhvfvcvqdrppghpqgscaqrgsrevfqafmekiqtdpqlfmttvitptgcmnacm
    mgpvvvvypdgvwygqvkpedvdeivekhlkggepverlviskgkppgm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f37B (B:)
    aefkhvfvcvqdrppghpqgscaqrgsrevfqafmekiqtdpqlfmttvitptgcmnacm
    mgpvvvvypdgvwygqvkpedvdeivekhlkggepverlviskgkppgmf