Lineage for d5ka4a_ (5ka4 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483190Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2483235Protein Tyrosine phosphatase [52806] (7 species)
  7. 2483236Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (263 PDB entries)
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 2483466Domain d5ka4a_: 5ka4 A: [330786]
    automated match to d2cnia_
    mutant

Details for d5ka4a_

PDB Entry: 5ka4 (more details), 2.19 Å

PDB Description: protein tyrosine phosphatase 1b t178a mutant, open state
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d5ka4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ka4a_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhytawpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfi

SCOPe Domain Coordinates for d5ka4a_:

Click to download the PDB-style file with coordinates for d5ka4a_.
(The format of our PDB-style files is described here.)

Timeline for d5ka4a_: