Lineage for d5ifhl2 (5ifh L:111-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751220Domain d5ifhl2: 5ifh L:111-212 [330728]
    Other proteins in same PDB: d5ifhh1, d5ifhh2, d5ifhl1
    automated match to d1lila2

Details for d5ifhl2

PDB Entry: 5ifh (more details), 2.29 Å

PDB Description: crystal structure of the bcr fab fragment from subset #2 case p11475
PDB Compounds: (L:) Light chain of the Fab fragment from BCR derived from the P11475 CLL clone

SCOPe Domain Sequences for d5ifhl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ifhl2 b.1.1.2 (L:111-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5ifhl2:

Click to download the PDB-style file with coordinates for d5ifhl2.
(The format of our PDB-style files is described here.)

Timeline for d5ifhl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ifhl1