PDB entry 5ifh

View 5ifh on RCSB PDB site
Description: Crystal structure of the BCR Fab fragment from subset #2 case P11475
Class: immune system
Keywords: Immunoglobulin fold, B cell receptor, chronic lymphocytic leukemia, immune system
Deposited on 2016-02-26, released 2017-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of the Fab fragment from BCR derived from the P11475 CLL clone
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IFH
    Domains in SCOPe 2.07: d5ifhh1, d5ifhh2
  • Chain 'L':
    Compound: Light chain of the Fab fragment from BCR derived from the P11475 CLL clone
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IFH
    Domains in SCOPe 2.07: d5ifhl1, d5ifhl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ifhH (H:)
    evqlvesggglvkpggslrlscaasgftfrsysmnwvrqapgkglewvssiissssyiyy
    adsvkgrftisrdnaknslylqmnslraedtalyycardqnamdvwgqgttvtvssdsas
    aptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggk
    yaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ifhH (H:)
    vqlvesggglvkpggslrlscaasgftfrsysmnwvrqapgkglewvssiissssyiyya
    dsvkgrftisrdnaknslylqmnslraedtalyycardqnamdvwgqgttvtvssdsasa
    ptlfplvsvgclaqdflpdsitfswgfpsvlrggkyaatsqvvckvqhpngnkeknvp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5ifhL (L:)
    syeltqppsvsvapgktaritcagnnigsksvhwyqqkpgqapvlviyydsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsgsdhpwvfgggtkltvlrqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ifhL (L:)
    yeltqppsvsvapgktaritcagnnigsksvhwyqqkpgqapvlviyydsdrpsgiperf
    sgsnsgntatltisrveagdeadyycqvwdsgsdhpwvfgggtkltvlrqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvapt