Lineage for d5kaba_ (5kab A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130872Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2130873Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2131302Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2131303Protein automated matches [190475] (8 species)
    not a true protein
  7. 2131315Species Human (Homo sapiens) [TaxId:9606] [187400] (117 PDB entries)
  8. 2131427Domain d5kaba_: 5kab A: [330706]
    automated match to d2i1yb_
    complexed with cl, gol, ota, trs; mutant

Details for d5kaba_

PDB Entry: 5kab (more details), 1.97 Å

PDB Description: protein tyrosine phosphatase 1b delta helix 7, p185g mutant in complex with tcs401, open state
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d5kaba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaba_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvgespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

SCOPe Domain Coordinates for d5kaba_:

Click to download the PDB-style file with coordinates for d5kaba_.
(The format of our PDB-style files is described here.)

Timeline for d5kaba_: