SCOPe 2.07: Domain d5ka7a1: 5ka7 A:1-297

Lineage for d5ka7a1 (5ka7 A:1-297)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (263 PDB entries)
   Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299

8. Domain d5ka7a1: 5ka7 A:1-297 [330693]
   Other proteins in same PDB: d5ka7a2
   automated match to d2cnia_
   complexed with cl, gol, ota, trs; mutant

Details for d5ka7a1

PDB Entry: 5ka7, 2.06 Å

PDB Description: protein tyrosine phosphatase 1b t178a mutant in complex with tcs401, closed state

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d5ka7a1:

Sequence; same for both SEQRES and ATOM records:

>d5ka7a1 c.45.1.2 (A:1-297) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhytawp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshe

Timeline for d5ka7a1:

• d5ka7a1 first appeared in SCOPe 2.06
  
• d5ka7a1 appears in the current release, SCOPe 2.08