Class a: All alpha proteins [46456] (290 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein Bile acid receptor FXR [101433] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101434] (8 PDB entries) |
Domain d5ickb_: 5ick B: [330672] automated match to d3ruua_ complexed with fez |
PDB Entry: 5ick (more details), 2.47 Å
SCOPe Domain Sequences for d5ickb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ickb_ a.123.1.1 (B:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq
Timeline for d5ickb_: