SCOPe 2.07: Domain d5j5ff1: 5j5f F:1-210

Lineage for d5j5ff1 (5j5f F:1-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (35 PDB entries)

8. Domain d5j5ff1: 5j5f F:1-210 [330665]
   Other proteins in same PDB: d5j5ff2
   automated match to d3u8kd_
   complexed with 6gh, dms, gol, nag, po4

Details for d5j5ff1

PDB Entry: 5j5f, 2.04 Å

PDB Description: x-ray crystal structure of acetylcholine binding protein (achbp) in complex with n4,n4-bis[(pyridin-2-yl)methyl]-6-(thiophen-3-yl) pyrimidine-2,4-diamine

PDB Compounds: (F:) acetylcholine-binding protein

SCOPe Domain Sequences for d5j5ff1:

Sequence, based on SEQRES records:

>d5j5ff1 b.96.1.1 (F:1-210) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkgrseil

Sequence, based on observed residues (ATOM records):

>d5j5ff1 b.96.1.1 (F:1-210) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildvtqkknsvt
ysccpeayedvevslnfrkkgrseil

Timeline for d5j5ff1:

• d5j5ff1 first appeared in SCOPe 2.06
  
• d5j5ff1 appears in the current release, SCOPe 2.08