![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
![]() | Domain d5h07a3: 5h07 A:201-271 [330644] automated match to d2k39a_ |
PDB Entry: 5h07 (more details), 2.59 Å
SCOPe Domain Sequences for d5h07a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h07a3 d.15.1.0 (A:201-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvl
Timeline for d5h07a3: