Lineage for d5tx2a_ (5tx2 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638316Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2638317Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2638412Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 2638499Protein TGF-beta2 [57510] (2 species)
  7. 2638509Species Mouse (Mus musculus) [TaxId:10090] [330451] (2 PDB entries)
  8. 2638510Domain d5tx2a_: 5tx2 A: [330514]
    automated match to d2tgia_
    mutant

Details for d5tx2a_

PDB Entry: 5tx2 (more details), 1.82 Å

PDB Description: miniature tgf-beta2 3-mutant monomer
PDB Compounds: (A:) Transforming growth factor beta-2

SCOPe Domain Sequences for d5tx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tx2a_ g.17.1.2 (A:) TGF-beta2 {Mouse (Mus musculus) [TaxId: 10090]}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpyraskspscvs
qdlepltilyyigntpkieqlsnmivksckcs

SCOPe Domain Coordinates for d5tx2a_:

Click to download the PDB-style file with coordinates for d5tx2a_.
(The format of our PDB-style files is described here.)

Timeline for d5tx2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5tx2b_