SCOPe 2.07: Domain d5tx4a_: 5tx4 A:

Lineage for d5tx4a_ (5tx4 A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
   elaborated with additional structures resulting in a beta-sandwich fold

7. Species Human (Homo sapiens) [TaxId:9606] [69952] (9 PDB entries)

8. Domain d5tx4a_: 5tx4 A: [330457]
   Other proteins in same PDB: d5tx4b_
   automated match to d1ploa_

Details for d5tx4a_

PDB Entry: 5tx4, 1.88 Å

PDB Description: derivative of mouse tgf-beta2, with a deletion of residues 52-71 and k25r, r26k, l51r, a74k, c77s, l89v, i92v, k94r t95k, i98v single amino acid substitutions, bound to human tgf-beta type ii receptor ectodomain residues 15-130

PDB Compounds: (A:) TGF-beta receptor type-2

SCOPe Domain Sequences for d5tx4a_:

Sequence; same for both SEQRES and ATOM records:

>d5tx4a_ g.7.1.3 (A:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
avkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchd
pklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniifs

Timeline for d5tx4a_:

• d5tx4a_ first appeared in SCOPe 2.06
  
• d5tx4a_ appears in the current release, SCOPe 2.08