Lineage for d5tx4a_ (5tx4 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2637112Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2637152Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 2637155Species Human (Homo sapiens) [TaxId:9606] [69952] (9 PDB entries)
  8. 2637160Domain d5tx4a_: 5tx4 A: [330457]
    Other proteins in same PDB: d5tx4b_
    automated match to d1ploa_

Details for d5tx4a_

PDB Entry: 5tx4 (more details), 1.88 Å

PDB Description: derivative of mouse tgf-beta2, with a deletion of residues 52-71 and k25r, r26k, l51r, a74k, c77s, l89v, i92v, k94r t95k, i98v single amino acid substitutions, bound to human tgf-beta type ii receptor ectodomain residues 15-130
PDB Compounds: (A:) TGF-beta receptor type-2

SCOPe Domain Sequences for d5tx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tx4a_ g.7.1.3 (A:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
avkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchd
pklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniifs

SCOPe Domain Coordinates for d5tx4a_:

Click to download the PDB-style file with coordinates for d5tx4a_.
(The format of our PDB-style files is described here.)

Timeline for d5tx4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5tx4b_