Lineage for d1f2ec2 (1f2e C:1-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484705Protein Class beta GST [81368] (4 species)
  7. 2484721Species Sphingomonas paucimobilis [TaxId:13689] [52885] (1 PDB entry)
  8. 2484724Domain d1f2ec2: 1f2e C:1-80 [33041]
    Other proteins in same PDB: d1f2ea1, d1f2eb1, d1f2ec1, d1f2ed1
    complexed with gsh

Details for d1f2ec2

PDB Entry: 1f2e (more details), 2.3 Å

PDB Description: structure of sphingomonad, glutathione s-transferase complexed with glutathione
PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d1f2ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2ec2 c.47.1.5 (C:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]}
mklfispgacslaphialretgadfeavkvdlavrkteagedfltvnpsgkvpaltldsg
etltenpaillyiadqnpas

SCOPe Domain Coordinates for d1f2ec2:

Click to download the PDB-style file with coordinates for d1f2ec2.
(The format of our PDB-style files is described here.)

Timeline for d1f2ec2: