SCOPe 2.01: Domain d2pmtd2: 2pmt D:1-80

Lineage for d2pmtd2 (2pmt D:1-80)

Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
Protein Class beta GST [81368] (3 species)
Species Proteus mirabilis [TaxId:584] [52884] (2 PDB entries)
Domain d2pmtd2: 2pmt D:1-80 [33038]
Other proteins in same PDB: d2pmta1, d2pmtb1, d2pmtc1, d2pmtd1
complexed with gsh

Details for d2pmtd2

PDB Entry: 2pmt (more details), 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis

PDB Compounds: (D:) glutathione transferase

SCOPe Domain Sequences for d2pmtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmtd2 c.47.1.5 (D:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]}
mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
diltegvaivqyladlkpdr

SCOPe Domain Coordinates for d2pmtd2:

Click to download the PDB-style file with coordinates for d2pmtd2.
(The format of our PDB-style files is described here.)

Timeline for d2pmtd2: