Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class beta GST [81368] (3 species) |
Species Proteus mirabilis [TaxId:584] [52884] (2 PDB entries) |
Domain d2pmtd2: 2pmt D:1-80 [33038] Other proteins in same PDB: d2pmta1, d2pmtb1, d2pmtc1, d2pmtd1 complexed with gsh |
PDB Entry: 2pmt (more details), 2.7 Å
SCOPe Domain Sequences for d2pmtd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pmtd2 c.47.1.5 (D:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng diltegvaivqyladlkpdr
Timeline for d2pmtd2: