Lineage for d5b66e_ (5b66 E:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254945Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2254946Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2254947Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)
  7. 2254951Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (10 PDB entries)
  8. 2254955Domain d5b66e_: 5b66 E: [330313]
    Other proteins in same PDB: d5b66d_, d5b66f_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66x_
    automated match to d2axte1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66e_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5b66e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66e_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfle

SCOPe Domain Coordinates for d5b66e_:

Click to download the PDB-style file with coordinates for d5b66e_.
(The format of our PDB-style files is described here.)

Timeline for d5b66e_: