Lineage for d5khlb1 (5khl B:24-277)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519619Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2519730Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2520116Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2520117Protein automated matches [190944] (40 species)
    not a true protein
  7. 2520281Species Vibrio cholerae [TaxId:345073] [330007] (2 PDB entries)
  8. 2520282Domain d5khlb1: 5khl B:24-277 [330131]
    Other proteins in same PDB: d5khlb2
    automated match to d2rg7a_
    complexed with so4

Details for d5khlb1

PDB Entry: 5khl (more details), 2.4 Å

PDB Description: crystal structure of periplasmic heme binding protein hutb of vibrio cholerae
PDB Compounds: (B:) Hemin ABC transporter, periplasmic hemin-binding protein HutB

SCOPe Domain Sequences for d5khlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5khlb1 c.92.2.0 (B:24-277) automated matches {Vibrio cholerae [TaxId: 345073]}
rivsagsavtelilalgaeqqlvavdvtsevpsslnlptvgyhrrlaaeglltlepthli
gsdemgpdtalqqlrssgiqvnvinsdstpqglltridqiaqithteqhaqklkenvqqq
inalqakrpekpkkvlflllhegraanvagsdtvpdtiigligahnpaspsitsykplsm
esmiemqpdmvlvsgrsleklggadavlnavpmlaatpagqnknivaidghalvgglglk
slqeaqriqtllyp

SCOPe Domain Coordinates for d5khlb1:

Click to download the PDB-style file with coordinates for d5khlb1.
(The format of our PDB-style files is described here.)

Timeline for d5khlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5khlb2