Lineage for d1eema2 (1eem A:5-102)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484852Protein Class omega GST [81363] (1 species)
  7. 2484853Species Human (Homo sapiens) [TaxId:9606] [52877] (17 PDB entries)
  8. 2484857Domain d1eema2: 1eem A:5-102 [33011]
    Other proteins in same PDB: d1eema1
    complexed with gsh, so4

Details for d1eema2

PDB Entry: 1eem (more details), 2 Å

PDB Description: glutathione transferase from homo sapiens
PDB Compounds: (A:) glutathione-s-transferase

SCOPe Domain Sequences for d1eema2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff
kknpfglvpvlensqgqliyesaitceyldeaypgkkl

SCOPe Domain Coordinates for d1eema2:

Click to download the PDB-style file with coordinates for d1eema2.
(The format of our PDB-style files is described here.)

Timeline for d1eema2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eema1