Lineage for d1gsq_2 (1gsq 1-75)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396311Protein Class sigma GST [81362] (4 species)
  7. 396327Species Squid (Ommastrephes sloani pacificus) [TaxId:6634] [52876] (2 PDB entries)
  8. 396329Domain d1gsq_2: 1gsq 1-75 [33010]
    Other proteins in same PDB: d1gsq_1
    complexed with gdb

Details for d1gsq_2

PDB Entry: 1gsq (more details), 2.4 Å

PDB Description: three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods

SCOP Domain Sequences for d1gsq_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsq_2 c.47.1.5 (1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus)}
pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
sqsmciarhlarefg

SCOP Domain Coordinates for d1gsq_2:

Click to download the PDB-style file with coordinates for d1gsq_2.
(The format of our PDB-style files is described here.)

Timeline for d1gsq_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsq_1