PDB entry 1gsq

View 1gsq on RCSB PDB site
Description: three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods
Deposited on 1995-01-09, released 1995-06-03
The last revision prior to the SCOP 1.67 freeze date was dated 1995-06-03, with a file datestamp of 1995-06-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.18
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gsq_ (-)
    pkytlhyfplmgraelcrfvlaahgeeftdrvvemadwpnlkatmysnampvldidgtkm
    sqsmciarhlarefgldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnye
    ksckrlapflegllvsngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkival
    rkrvaecpkiaaylkkrpvrdf