Lineage for d5itwc1 (5itw C:3-255)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846126Species Bacillus subtilis [TaxId:224308] [330028] (2 PDB entries)
  8. 2846129Domain d5itwc1: 5itw C:3-255 [330082]
    Other proteins in same PDB: d5itwa2, d5itwb2, d5itwc2, d5itwd2
    automated match to d4za2a_
    complexed with so4

Details for d5itwc1

PDB Entry: 5itw (more details), 1.19 Å

PDB Description: crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase
PDB Compounds: (C:) Dihydroanticapsin 7-dehydrogenase

SCOPe Domain Sequences for d5itwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5itwc1 c.2.1.0 (C:3-255) automated matches {Bacillus subtilis [TaxId: 224308]}
mnltdktvlitggasgigyaavqaflgqqanvvvadideaqgeamvrkenndrlhfvqtd
itdeaacqhavesavhtfggldvlinnagieivapihemelsdwnkvlqvnltgmflmsk
halkhmlaagkgniintcsvgglvawpdipaynaskggvlqltksmavdyakhqirvncv
cpgiidtplneksflennegtleeikkekakvnpllrlgkpeeianvmlflasdlssymt
gsaitadggytaq

SCOPe Domain Coordinates for d5itwc1:

Click to download the PDB-style file with coordinates for d5itwc1.
(The format of our PDB-style files is described here.)

Timeline for d5itwc1: