Lineage for d1ljrb2 (1ljr B:1-79)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699243Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 699682Protein Class theta GST [81361] (1 species)
  7. 699683Species Human (Homo sapiens) [TaxId:9606] [52874] (3 PDB entries)
  8. 699685Domain d1ljrb2: 1ljr B:1-79 [33002]
    Other proteins in same PDB: d1ljra1, d1ljrb1
    complexed with gtt

Details for d1ljrb2

PDB Entry: 1ljr (more details), 3.2 Å

PDB Description: glutathione transferase (hgst t2-2) from human
PDB Compounds: (B:) glutathione s-transferase

SCOP Domain Sequences for d1ljrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ljrb2 c.47.1.5 (B:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}
mglelfldlvsqpsravyifakkngiplelrtvdlvkgqhkskeflqinslgklptlkdg
dfiltessailiylsckyq

SCOP Domain Coordinates for d1ljrb2:

Click to download the PDB-style file with coordinates for d1ljrb2.
(The format of our PDB-style files is described here.)

Timeline for d1ljrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ljrb1