| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class alpha GST [81360] (8 species) |
| Species Norway rat (Rattus norvegicus), (a1-1) [TaxId:10116] [52871] (2 PDB entries) |
| Domain d1ev9c2: 1ev9 C:2-79 [32991] Other proteins in same PDB: d1ev9a1, d1ev9c1, d1ev9d1 complexed with gts, so4; mutant |
PDB Entry: 1ev9 (more details), 2.2 Å
SCOPe Domain Sequences for d1ev9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev9c2 c.47.1.5 (C:2-79) Class alpha GST {Norway rat (Rattus norvegicus), (a1-1) [TaxId: 10116]}
sgkpvlhyfnargrmecirfllaaagvefdekfiqspedleklkkdgnlmfdqvpmveid
gmklaqtrailnyiatky
Timeline for d1ev9c2:
View in 3DDomains from other chains: (mouse over for more information) d1ev9a1, d1ev9a2, d1ev9d1, d1ev9d2 |