| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class alpha GST [81349] (8 species) |
| Species Norway rat (Rattus norvegicus), (a1-1) [TaxId:10116] [47626] (2 PDB entries) |
| Domain d1ev9a1: 1ev9 A:80-220 [17696] Other proteins in same PDB: d1ev9a2, d1ev9c2, d1ev9d2 complexed with gts, so4; mutant |
PDB Entry: 1ev9 (more details), 2.2 Å
SCOPe Domain Sequences for d1ev9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev9a1 a.45.1.1 (A:80-220) Class alpha GST {Norway rat (Rattus norvegicus), (a1-1) [TaxId: 10116]}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpmdakqieearkif
Timeline for d1ev9a1:
View in 3DDomains from other chains: (mouse over for more information) d1ev9c1, d1ev9c2, d1ev9d1, d1ev9d2 |