Lineage for d5mt0a1 (5mt0 A:16-243)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2066146Protein automated matches [190044] (14 species)
    not a true protein
  7. 2066187Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)
  8. 2066195Domain d5mt0a1: 5mt0 A:16-243 [329889]
    Other proteins in same PDB: d5mt0a2
    automated match to d1op8a_
    complexed with qjs, so4

Details for d5mt0a1

PDB Entry: 5mt0 (more details), 1.29 Å

PDB Description: complement factor d in complex with a reversible indole carboxylic acid based inhibitor
PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d5mt0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mt0a1 b.47.1.2 (A:16-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d5mt0a1:

Click to download the PDB-style file with coordinates for d5mt0a1.
(The format of our PDB-style files is described here.)

Timeline for d5mt0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mt0a2