Lineage for d1gulh2 (1gul H:4-80)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1600825Protein Class alpha GST [81360] (8 species)
  7. 1600838Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (27 PDB entries)
    Uniprot P08263
  8. 1600912Domain d1gulh2: 1gul H:4-80 [32976]
    Other proteins in same PDB: d1gula1, d1gulb1, d1gulc1, d1guld1, d1gule1, d1gulf1, d1gulg1, d1gulh1

Details for d1gulh2

PDB Entry: 1gul (more details), 2.7 Å

PDB Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione
PDB Compounds: (H:) glutathione transferase a4-4

SCOPe Domain Sequences for d1gulh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gulh2 c.47.1.5 (H:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
klvqtrsilhyiadkhn

SCOPe Domain Coordinates for d1gulh2:

Click to download the PDB-style file with coordinates for d1gulh2.
(The format of our PDB-style files is described here.)

Timeline for d1gulh2: