SCOPe 2.06: Domain d5tr2a4: 5tr2 A:422-562

Lineage for d5tr2a4 (5tr2 A:422-562)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families)
   contains a single copy of this fold and an extra beta-strand at the C-terminus

5. Family d.129.2.0: automated matches [254315] (1 protein)
   not a true family

6. Protein automated matches [254722] (3 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [316258] (5 PDB entries)

8. Domain d5tr2a4: 5tr2 A:422-562 [329666]
   Other proteins in same PDB: d5tr2a1, d5tr2a2, d5tr2a3, d5tr2a5, d5tr2b1, d5tr2b2, d5tr2b3
   automated match to d5f9ca4
   complexed with ca, gol, so4

Details for d5tr2a4

PDB Entry: 5tr2, 2.5 Å

PDB Description: crystal structure of the d263g missense variant of human pgm1

PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5tr2a4:

Sequence, based on SEQRES records:

>d5tr2a4 d.129.2.0 (A:422-562) automated matches {Homo sapiens [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

Sequence, based on observed residues (ATOM records):

>d5tr2a4 d.129.2.0 (A:422-562) automated matches {Homo sapiens [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtagatirlyidsyekdvakinqdpqvmlaplisia
lkvsqlqertgrtaptvit

Timeline for d5tr2a4:

• d5tr2a4 is new in SCOPe 2.06-stable
  
• d5tr2a4 appears in SCOPe 2.07
  
• d5tr2a4 appears in the current release, SCOPe 2.08