Lineage for d5b5eh_ (5b5e H:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254818Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. 2254819Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2254820Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 2254826Species Thermosynechococcus vulcanus [TaxId:32053] [267726] (6 PDB entries)
  8. 2254828Domain d5b5eh_: 5b5e H: [329388]
    Other proteins in same PDB: d5b5ea_, d5b5ef_, d5b5ei_, d5b5ej_, d5b5el_, d5b5ev_, d5b5ex_, d5b5ez_
    automated match to d2axth1
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b5eh_

PDB Entry: 5b5e (more details), 1.87 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5b5eh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5eh_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus vulcanus [TaxId: 32053]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d5b5eh_:

Click to download the PDB-style file with coordinates for d5b5eh_.
(The format of our PDB-style files is described here.)

Timeline for d5b5eh_: