Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (16 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
Protein Class mu GST [81359] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries) |
Domain d2gsta2: 2gst A:1-84 [32923] Other proteins in same PDB: d2gsta1, d2gstb1 |
PDB Entry: 2gst (more details), 1.8 Å
SCOP Domain Sequences for d2gsta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gsta2 c.47.1.5 (A:1-84) Class mu GST {Rat (Rattus norvegicus)} pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp ylidgsrkitqsnaimrylarkhh
Timeline for d2gsta2: