SCOP 1.55: Domain d2gsta2: 2gst A:1-84

Lineage for d2gsta2 (2gst A:1-84)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)

8. Domain d2gsta2: 2gst A:1-84 [32923]
   Other proteins in same PDB: d2gsta1, d2gstb1

Details for d2gsta2

PDB Entry: 2gst, 1.8 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene

SCOP Domain Sequences for d2gsta2:

Sequence; same for both SEQRES and ATOM records:

>d2gsta2 c.47.1.5 (A:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

Timeline for d2gsta2:

• d2gsta2 appears in SCOP 1.57
  
• d2gsta2 appears in the current release, SCOPe 2.08