Lineage for d5h5ja2 (5h5j A:158-317)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2468165Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2468166Protein automated matches [226871] (19 species)
    not a true protein
  7. 2468205Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries)
  8. 2468227Domain d5h5ja2: 5h5j A:158-317 [329185]
    Other proteins in same PDB: d5h5ja1, d5h5jb_, d5h5jc1
    automated match to d3lo8a2
    complexed with fad, fes

Details for d5h5ja2

PDB Entry: 5h5j (more details), 2.5 Å

PDB Description: complex between ferredoxin and ferredoxin-nadp+ reductase from maize root
PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d5h5ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h5ja2 c.25.1.0 (A:158-317) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkvlsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl
kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhvevy

SCOPe Domain Coordinates for d5h5ja2:

Click to download the PDB-style file with coordinates for d5h5ja2.
(The format of our PDB-style files is described here.)

Timeline for d5h5ja2: