| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
| Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
| Protein automated matches [191197] (13 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries) |
| Domain d5wrza2: 5wrz A:797-1011 [329091] Other proteins in same PDB: d5wrza1, d5wrza3, d5wrzb1, d5wrzb3 automated match to d4hhyd2 complexed with 7u3 |
PDB Entry: 5wrz (more details), 2.2 Å
SCOPe Domain Sequences for d5wrza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wrza2 d.166.1.0 (A:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d5wrza2: