![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
![]() | Protein automated matches [191197] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries) |
![]() | Domain d4hhyd2: 4hhy D:136-343 [222609] Other proteins in same PDB: d4hhya1, d4hhyb1, d4hhyc1, d4hhyd1 automated match to d1gs0a2 complexed with 15r, peg, so4 |
PDB Entry: 4hhy (more details), 2.36 Å
SCOPe Domain Sequences for d4hhyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hhyd2 d.166.1.0 (D:136-343) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllk
Timeline for d4hhyd2: