SCOPe 2.08: Domain d4hhyd2: 4hhy D:136-343

Lineage for d4hhyd2 (4hhy D:136-343)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.166: ADP-ribosylation [56398] (1 superfamily)
unusual fold
Superfamily d.166.1: ADP-ribosylation [56399] (8 families)
Family d.166.1.0: automated matches [191650] (1 protein)
not a true family
Protein automated matches [191197] (13 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries)
Domain d4hhyd2: 4hhy D:136-343 [222609]
Other proteins in same PDB: d4hhya1, d4hhyb1, d4hhyc1, d4hhyd1
automated match to d1gs0a2
complexed with 15r, peg, so4

Details for d4hhyd2

PDB Entry: 4hhy (more details), 2.36 Å

PDB Description: Crystal structure of PARP catalytic domain in complex with novel inhibitors

PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4hhyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhyd2 d.166.1.0 (D:136-343) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllk

SCOPe Domain Coordinates for d4hhyd2:

Click to download the PDB-style file with coordinates for d4hhyd2.
(The format of our PDB-style files is described here.)

Timeline for d4hhyd2: