SCOPe 2.06: Domain d5hnnc1: 5hnn C:2-317

Lineage for d5hnnc1 (5hnn C:2-317)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)

8. Domain d5hnnc1: 5hnn C:2-317 [328892]
   Other proteins in same PDB: d5hnna2, d5hnnc2
   automated match to d1gzja_
   complexed with gol; mutant

Details for d5hnnc1

PDB Entry: 5hnn, 1.63 Å

PDB Description: crystal structure of the endo-beta-1,4-glucanase (xac0030) from xanthomonas axonopodis pv. citri with the triple mutation his174trp, tyr211ala and lys227arg.

PDB Compounds: (C:) cellulase

SCOPe Domain Sequences for d5hnnc1:

Sequence; same for both SEQRES and ATOM records:

>d5hnnc1 c.1.8.0 (C:2-317) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
lkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpelng
pldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlalef
kddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgawswrstsy
gvsnakaleilkdpgnnlafeahqyldkdasgtkpvctsdsvgqerlqgftswlrenkqk
gflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgsd
kpqmailskyarragk

Timeline for d5hnnc1:

• d5hnnc1 is new in SCOPe 2.06-stable
  
• d5hnnc1 appears in SCOPe 2.07
  
• d5hnnc1 appears in the current release, SCOPe 2.08