Lineage for d5hk4e1 (5hk4 E:1-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559642Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2559863Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2559864Protein automated matches [226983] (27 species)
    not a true protein
  7. 2560037Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)
  8. 2560072Domain d5hk4e1: 5hk4 E:1-138 [328708]
    Other proteins in same PDB: d5hk4a2, d5hk4b2, d5hk4c2, d5hk4d2, d5hk4e2, d5hk4f2
    automated match to d4lf2a1
    complexed with cap, mg; mutant

Details for d5hk4e1

PDB Entry: 5hk4 (more details), 2.15 Å

PDB Description: structure function studies of r. palustris rubisco (a47v-m331a mutant)
PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hk4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hk4e1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5hk4e1:

Click to download the PDB-style file with coordinates for d5hk4e1.
(The format of our PDB-style files is described here.)

Timeline for d5hk4e1: