| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
| Protein automated matches [226983] (27 species) not a true protein |
| Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries) |
| Domain d5hk4e1: 5hk4 E:1-138 [328708] Other proteins in same PDB: d5hk4a2, d5hk4b2, d5hk4c2, d5hk4d2, d5hk4e2, d5hk4f2 automated match to d4lf2a1 complexed with cap, mg; mutant |
PDB Entry: 5hk4 (more details), 2.15 Å
SCOPe Domain Sequences for d5hk4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hk4e1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd
Timeline for d5hk4e1: