Lineage for d1eoha2 (1eoh A:1-76)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1368986Protein Class pi GST [81358] (4 species)
  7. 1368987Species Human (Homo sapiens) [TaxId:9606] [52864] (49 PDB entries)
  8. 1369083Domain d1eoha2: 1eoh A:1-76 [32868]
    Other proteins in same PDB: d1eoha1, d1eohb1, d1eohc1, d1eohd1, d1eohe1, d1eohf1, d1eohg1, d1eohh1

Details for d1eoha2

PDB Entry: 1eoh (more details), 2.5 Å

PDB Description: glutathione transferase p1-1
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d1eoha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eoha2 c.47.1.5 (A:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOPe Domain Coordinates for d1eoha2:

Click to download the PDB-style file with coordinates for d1eoha2.
(The format of our PDB-style files is described here.)

Timeline for d1eoha2: