SCOPe 2.03: Domain d1eohc1: 1eoh C:77-209

Lineage for d1eohc1 (1eoh C:77-209)

Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
Protein Class pi GST [81347] (4 species)
Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries)
Domain d1eohc1: 1eoh C:77-209 [17576]
Other proteins in same PDB: d1eoha2, d1eohb2, d1eohc2, d1eohd2, d1eohe2, d1eohf2, d1eohg2, d1eohh2

Details for d1eohc1

PDB Entry: 1eoh (more details), 2.5 Å

PDB Description: glutathione transferase p1-1

PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d1eohc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eohc1 a.45.1.1 (C:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfaaynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d1eohc1:

Click to download the PDB-style file with coordinates for d1eohc1.
(The format of our PDB-style files is described here.)

Timeline for d1eohc1: