SCOPe 2.08: Domain d5hjxd1: 5hjx D:1-138

Lineage for d5hjxd1 (5hjx D:1-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)

8. Domain d5hjxd1: 5hjx D:1-138 [328666]
   Other proteins in same PDB: d5hjxa2, d5hjxb2, d5hjxc2, d5hjxd2, d5hjxe2, d5hjxf2
   automated match to d4lf2a1
   complexed with cap, mg; mutant

Details for d5hjxd1

PDB Entry: 5hjx, 1.8 Å

PDB Description: structure function studies of r. palustris rubisco (a47v mutant; cabp- bound)

PDB Compounds: (D:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hjxd1:

Sequence; same for both SEQRES and ATOM records:

>d5hjxd1 d.58.9.0 (D:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

Timeline for d5hjxd1:

• d5hjxd1 first appeared in SCOPe 2.06
  
• d5hjxd1 appears in SCOPe 2.07