Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (37 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323630] (11 PDB entries) |
Domain d5lnuc_: 5lnu C: [328665] automated match to d3fema_ complexed with kik, po4, so4 |
PDB Entry: 5lnu (more details), 1.73 Å
SCOPe Domain Sequences for d5lnuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lnuc_ c.1.2.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp arraraivqavthysdpemlvevscglgeamvginl
Timeline for d5lnuc_: