Lineage for d4gssb2 (4gss B:2-76)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992593Protein Class pi GST [81358] (4 species)
  7. 992594Species Human (Homo sapiens) [TaxId:9606] [52864] (41 PDB entries)
  8. 992663Domain d4gssb2: 4gss B:2-76 [32865]
    Other proteins in same PDB: d4gssa1, d4gssb1
    complexed with gtx, mes; mutant

Details for d4gssb2

PDB Entry: 4gss (more details), 2.5 Å

PDB Description: human glutathione s-transferase p1-1 y108f mutant
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4gssb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gssb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOPe Domain Coordinates for d4gssb2:

Click to download the PDB-style file with coordinates for d4gssb2.
(The format of our PDB-style files is described here.)

Timeline for d4gssb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gssb1