Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
Superfamily d.61.1: LigT-like [55144] (5 families) |
Family d.61.1.0: automated matches [191492] (1 protein) not a true family |
Protein automated matches [190796] (6 species) not a true protein |
Species Escherichia coli [TaxId:469008] [328566] (7 PDB entries) |
Domain d5ldic_: 5ldi C: [328591] automated match to d4qakb_ complexed with cl |
PDB Entry: 5ldi (more details), 2.1 Å
SCOPe Domain Sequences for d5ldic_:
Sequence, based on SEQRES records: (download)
>d5ldic_ d.61.1.0 (C:) automated matches {Escherichia coli [TaxId: 469008]} sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrp fhphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
>d5ldic_ d.61.1.0 (C:) automated matches {Escherichia coli [TaxId: 469008]} sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcrpfhph itllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
Timeline for d5ldic_: