Lineage for d4qakb_ (4qak B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.61: LigT-like [55143] (1 superfamily)
duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and IIISuperfamily d.61.1: LigT-like [55144] (5 families) 
Family d.61.1.0: automated matches [191492] (1 protein)
not a true familyProtein automated matches [190796] (6 species)
not a true protein
Species Escherichia coli [TaxId:83333] [260567] (1 PDB entry) 
Domain d4qakb_: 4qak B: [260568]
automated match to d1iuha_
complexed with 2am, gol
Details for d4qakb_
PDB Entry: 4qak (more details), 2.02 Å
PDB Description: Crystal structure of phosphoesterase
PDB Compounds: (B:) 2'-5'-RNA ligaseSCOPe Domain Sequences for d4qakb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qakb_ d.61.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
epqrlffaidlpaeireqiihwrathfppeagrpvaadnlhltlaflgevsaekekalsl
lagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrpf
hphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq
SCOPe Domain Coordinates for d4qakb_:
Click to download the PDB-style file with coordinates for d4qakb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4qakb_:
- d4qakb_ first appeared in SCOPe 2.04
- d4qakb_ appears in SCOPe 2.07
View in 3D
