Lineage for d5cird_ (5cir D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048772Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2048773Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2048774Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2049069Protein automated matches [190204] (3 species)
    not a true protein
  7. 2049070Species Human (Homo sapiens) [TaxId:9606] [186956] (11 PDB entries)
  8. 2049101Domain d5cird_: 5cir D: [328550]
    automated match to d1d4vb_
    complexed with cl, zn

Details for d5cird_

PDB Entry: 5cir (more details), 3 Å

PDB Description: crystal structure of death receptor 4 (dr4; tnffrsf10a) bound to trail (tnfsf10)
PDB Compounds: (D:) Tumor necrosis factor ligand superfamily member 10

SCOPe Domain Sequences for d5cird_:

Sequence, based on SEQRES records: (download)

>d5cird_ b.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrngelvihe
kgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyg
lysiyqggifelkendrifvsvtnehlidmdheasffgaflvg

Sequence, based on observed residues (ATOM records): (download)

>d5cird_ b.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqrvaahitgtrekalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqtyfr
fqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggifelk
endrifvsvtnehlidmdheasffgaflvg

SCOPe Domain Coordinates for d5cird_:

Click to download the PDB-style file with coordinates for d5cird_.
(The format of our PDB-style files is described here.)

Timeline for d5cird_: