Lineage for d5hjxe1 (5hjx E:1-138)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195894Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2196090Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2196091Protein automated matches [226983] (18 species)
    not a true protein
  7. 2196234Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)
  8. 2196239Domain d5hjxe1: 5hjx E:1-138 [328502]
    Other proteins in same PDB: d5hjxa2, d5hjxb2, d5hjxc2, d5hjxd2, d5hjxe2, d5hjxf2
    automated match to d4lf2a1
    complexed with cap, mg; mutant

Details for d5hjxe1

PDB Entry: 5hjx (more details), 1.8 Å

PDB Description: structure function studies of r. palustris rubisco (a47v mutant; cabp- bound)
PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hjxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hjxe1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5hjxe1:

Click to download the PDB-style file with coordinates for d5hjxe1.
(The format of our PDB-style files is described here.)

Timeline for d5hjxe1: