Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (18 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries) |
Domain d5hjxe1: 5hjx E:1-138 [328502] Other proteins in same PDB: d5hjxa2, d5hjxb2, d5hjxc2, d5hjxd2, d5hjxe2, d5hjxf2 automated match to d4lf2a1 complexed with cap, mg; mutant |
PDB Entry: 5hjx (more details), 1.8 Å
SCOPe Domain Sequences for d5hjxe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hjxe1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve yakmydfyvppaylklfd
Timeline for d5hjxe1: