Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins) |
Protein Glutathione S-transferase [52863] (27 species) |
Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (33 PDB entries) |
Domain d4pgtb2: 4pgt B:1-76 [32849] Other proteins in same PDB: d4pgta1, d4pgtb1 |
PDB Entry: 4pgt (more details), 2.1 Å
SCOP Domain Sequences for d4pgtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pgtb2 c.47.1.5 (B:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi} ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl tlyqsntilrhlgrtl
Timeline for d4pgtb2: