| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins) |
| Protein Class pi GST [81358] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52864] (33 PDB entries) |
| Domain d5gssb2: 5gss B:2-76 [32847] Other proteins in same PDB: d5gssa1, d5gssb1 complexed with gtt, mes |
PDB Entry: 5gss (more details), 1.95 Å
SCOP Domain Sequences for d5gssb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gssb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens)}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl
Timeline for d5gssb2: