Lineage for d5ckma3 (5ckm A:165-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777704Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2777705Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)
  6. 2777739Protein automated matches [328442] (1 species)
    not a true protein
  7. 2777740Species Norway rat (Rattus norvegicus) [TaxId:10116] [328443] (3 PDB entries)
  8. 2777744Domain d5ckma3: 5ckm A:165-278 [328453]
    Other proteins in same PDB: d5ckma2
    automated match to d1nt0a2
    complexed with ca, nag

Details for d5ckma3

PDB Entry: 5ckm (more details), 2.73 Å

PDB Description: the cub1-egf-cub2 domains of rat mbl-associated serine protease-2 (masp-2) bound to ca2+
PDB Compounds: (A:) Mannan-binding lectin serine peptidase 2

SCOPe Domain Sequences for d5ckma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ckma3 b.23.1.1 (A:165-278) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
csgqvftgrsgflsspeypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpy
dslkiqtdkreygpfcgktlpprietdsnkvtitfttdesgnhtgwkihytsta

SCOPe Domain Coordinates for d5ckma3:

Click to download the PDB-style file with coordinates for d5ckma3.
(The format of our PDB-style files is described here.)

Timeline for d5ckma3: