PDB entry 5ckm

View 5ckm on RCSB PDB site
Description: The CUB1-EGF-CUB2 domains of rat MBL-associated serine protease-2 (MASP-2) bound to Ca2+
Class: hydrolase
Keywords: MASP, CUB1-EGF-CUB2, Complement activation, lectin pathway, hydrolase
Deposited on 2015-07-15, released 2017-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mannan-binding lectin serine peptidase 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Masp2, rCG_31002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ckma1, d5ckma2, d5ckma3
  • Heterogens: CA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ckmA (A:)
    kwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvklt
    sgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaedvd
    ecrtslgdsvpcdhychnylggyycscrvgyilhqnkhtcsalcsgqvftgrsgflsspe
    ypqpypklsscaynirleegfsitldfvesfdvemhpeaqcpydslkiqtdkreygpfcg
    ktlpprietdsnkvtitfttdesgnhtgwkihytsta